Posts matching the tag: Sex Art

Sex Art - Antonia Sainz - Change Of Mind

File: rlizonasearantsaivoif1bdkb7.mp4
Size: 1.38 GB
Duration: 24:41
Resolution: 1920x1080
Format: mp4
Description: Sexy brunette Antonia Sainz is in a rush to drink her morning coffee and get to work, but Nick Ross knows how to give her a Change Of Mind. As Andrej Lupins erotic movie begins, Nick grabs his sweethearts curvaceous ass and kisses her neck. She pushes him away, but soon relents and wraps her arms around him, rubbing his crotch and then unzipping his jeans and jerking his rigid cock.

Nick unbuttons Antonias shirt and fondles her beautiful big breasts, tugging her nipples playfully pulling down her panties and bending her over the kitchen counter, he thrusts into her from behind and fucks her to a breathless orgasm, her breasts bouncing and booty rippling with every stroke. Antonia kneels and takes Nicks cock in her mouth, gazing up at him as she sucks it eagerly, then she hops up onto the counter and he licks her pussy until shes gasping and moaning with every flick of his tongue. He penetrates her again, sucking her nipples and fucking her to one blissful peak after another. Wrapping her soft breasts around his shaft, Antonia titty-fucks Nick until his cum jets out all over her creamy cleavage.

Sex Art - Kaira Love & Ryana - Made A Star

File: qloqynasearkairyafz9i8s4qbv.mp4
Size: 1.20 GB
Duration: 21:31
Resolution: 1920x1080
Format: mp4
Description: Cute redhead Kaira Love is shooting a video of her sexy girlfriend Ryana, as Andrej Lupins erotic lesbian movie Made A Star begins. Ryana poses provocatively, exposing the neat bush that adorns her mound of Venus, and fondling her beautiful big breasts. Filming Ryana masturbating gets Kaira aroused too, and she doesnt hesitate when the busty blonde invites her to come closer. They kiss hungrily, Ryana squeezing her sweethearts ass through her tight jeans before tugging them down.

When she has Kaira perfectly naked, Ryana sucks her nipples and licks her shaved pussy, thrusting two fingers into her hot slot to drive her wild. Kaira has an intense orgasm, taking a moment to catch her breath before grinding on Ryanas soft thigh while frigging her to a powerful climax. The phones camera is still capturing every moment as they move into scissors, mashing their wet pussies together until they orgasm in unison, the perfect ending to their hot home movie.

Sex Art - Carolina Savage - Your Touch

File: evyygnasearcarsavkptfppvlyg.mp4
Size: 1.39 GB
Duration: 25:03
Resolution: 1920x1080
Format: mp4
Description: Sexy blonde Carolina Savage is in bed with Tommy Gold, their hands exploring amorously. As Andrej Lupins erotic movie Your Touch begins, the lovers kiss tenderly Tommy lifts his sweethearts sweater and sucks her stiff nipples as she grinds on the growing bulge in his briefs. Kissing his way down, Tommy licks Carolina through her panties, then peels them off and eats her shaved pussy until shes moaning and quivering with pleasure.

He penetrates her in missionary and fucks her to an orgasm shes eager to taste herself on his dick, licking it from root to tip before wrapping her lips around it for an intense blowjob. Straddling Tommy, Carolina rides him cowgirl style, wave after wave of bliss sweeping through her beautiful body. They switch to spoons, slamming together until Carolina orgasms again as Tommy fills her pussy with hot cum.

Sex Art - Abela Sott - Stop Talking

File: yvchtnasearabesotvplxjiiuny.mp4
Size: 1.24 GB
Duration: 22:25
Resolution: 1920x1080
Format: mp4
Description: Cute Abela Sott is flirting and chatting with Ricky, until she decides its time to Stop Talking and show her lover what she wants. As Andrej Lupins erotic movie begins, the sexy blonde undresses, then unzips Rickys jeans and sucks his stiff cock between eager kisses. She straddles his lap and grinds on his erection, teasing him further by dismounting and masturbating as he watches and does likewise. Unable to resist any longer, Ricky licks and fingerbangs Abelas drenched pussy, giving her an intense orgasm.

Now she moves astride him again, impaling herself on his rigid dick and sliding up and down until the powerful sensations overwhelm her. Ricky flips Abela onto her back and thrusts into her in missionary, her legs over his shoulders so he can fuck her deep and hard. She orgasms again and jerks his hot cum over her trembling body.

Sex Art - Jayla De Angelis - French Charm

File: pjsa4nasearjaydeangfrlp6jfe3y.mp4
Size: 1.36 GB
Duration: 24:03
Resolution: 1920x1080
Format: mp4
Description: Gorgeous Spanish blonde Jayla De Angelis is won over by Joshs French Charm as they flirt in his native language. As Andrej Lupins erotic movie begins, they share a romantic kiss she straddles his lap, untying the halter neck of her dress to expose her beautiful breasts, and he caresses them appreciatively. Jayla unzips her lovers jeans and licks his stiff cock from root to tip as the prelude to a sensual blowjob. Josh licks Jaylas shaved pussy, making her moan with arousal, then penetrates her in missionary and fucks her to an intense orgasm. They switch to doggy, Jayla slamming her sexy ass back to meet Joshs thrusts she moves astride him in a reverse cowgirl squat and rides vigorously, her breasts bouncing and her fingers on her clit. She has another powerful climax before Josh fills her pussy with creamy cum that drips out as they kiss adoringly.

Sex Art - Nata Ocean - Living It Up

File: sdmb8nasearnatocezeeqgbzukd.mp4
Size: 1.28 GB
Duration: 22:37
Resolution: 1920x1080
Format: mp4
Description: Cute brunette Nata Ocean distracts Tommy Gold from his work, as Andrej Lupins erotic movie Living It Up begins. She kisses him as she grinds in his lap, then peels off her sweater dress so he can squeeze her sexy ass through her pantyhose. Nata unzips Tommys pants, pulls down her nylons and panties and impales herself on his erection in reverse cowgirl. She slides up and down sensuously, bouncing more and more vigorously until shes overwhelmed by a powerful orgasm. Now Tommy bends Nata over and fucks her from behind, fondling her breasts and rubbing her clit to make her climax again. They switch to spoons, rocking together energetically until Natas most intense orgasm is triggered as Tommy fills her pussy with hot cum.

Sex Art - Sky Pierce - Whisper To You

File: pgtspnasearskypiepa4ysfqb7s.mp4
Size: 1.38 GB
Duration: 24:42
Resolution: 1920x1080
Format: mp4
Description: Gorgeous blonde Sky Pierce murmurs seductively into Nek Sinners ear, as Andrej Lupins erotic movie Whisper To You begins. She rubs his crotch as she tells him what she has in store for him, then straddles him and takes off her top so he can suck her nipples. Unzipping Neks pants, Sky engulfs his rigid cock in her mouth for a sensual blowjob, pausing to get naked and tease him with more dirty talk. She moves astride him, impaling herself and riding cowgirl style until an intense orgasm sweeps through her slender body. Nek licks Skys shaved pussy to make her climax again, then penetrates her in missionary, his powerful thrusts driving her wild. They switch to doggy, Neks fingers on Skys clit to give her another orgasm as he cums inside her creamy pussy.

Sex Art - Jessie Clark - Love Haze

File: xe5zhnasearjesclawemr98sr7e.mp4
Size: 1.22 GB
Duration: 21:50
Resolution: 1920x1080
Format: mp4
Description: The day gets off to a sexy start for gorgeous brunette Jessie Clark and her boyfriend, Ricky. As Andrej Lupins erotic movie Love Haze begins, the lovers make sizzling eye contact across the room, and Jessie opens her silk robe to display more of her ample cleavage. Ricky makes it clear hes enjoying the show as his sweetheart starts to caress her beautiful breasts. He joins her on the sofa, kissing and caressing her tenderly while she strokes the stiff dick thats tenting his shorts. Ricky lavishes attention on Jessies breasts, then licks her pussy, giving her a powerful orgasm. They hurry to get naked, and Ricky thrusts into Jessie, first in missionary and then in spoons, their bodies slamming together as he fucks her vigorously. Jessie climaxes again before sucking her wetness from Rickys rigid cock, her sensual blowjob making him gasp with arousal. She skewers herself on his erection in reverse cowgirl, her cute ass bouncing and her breasts jiggling wildly as she rides to another orgasm, then jerks out his hot cum as they kiss adoringly.

Sex Art - Lee Anne - Endless Love

File: tnbc3nasearleeannzt64c9lx7s.mp4
Size: 1.14 GB
Duration: 20:35
Resolution: 1920x1080
Format: mp4
Description: Gorgeous brunette Lee Anne smiles with sensual pleasure at Michael Flys tender embrace. As Andrej Lupins erotic movie Endless Love begins, Michaels hands roam, undressing his sweetheart and massaging lotion into her silky skin. He caresses Lee Annes perfect ass, then slides a hand between her thighs to stroke her pussy, making her moan with arousal. Lee Anne unzips Michaels pants and guides his stiff cock into her tight slot in spoons, rocking her sexy ass back to meet his vigorous thrusts. She rubs her clit as he fucks her to a powerful orgasm, then straddles him in cowgirl and rides until shes overwhelmed by another, even more intense one. When shes caught her breath, Michael resumes thrusting until they climax together, then cuddle through the afterglow of their lovemaking.Hide

Sex Art - Mona Blue - Bound By Love Part 2

File: qxhhanasearmonbluxcfdedwjga.mp4
Size: 1008.51 MB
Duration: 17:32
Resolution: 1920x1080
Format: mp4
Description: Its cute blonde Mona Blues turn to be restrained, in episode two of Andrej Lupins erotic series Bound By Love. The naked beautys wrists are strapped to the chair while Mugur sucks her nipples, making her squirm with arousal. He licks a trail down to her pussy, lapping at her clit and sliding his fingers into her juicy slot. Just as Mona starts to orgasm, Mugur replaces his fingers with his rigid cock, driving her wild. He fucks her to another climax, lifting her legs onto his shoulders so he can thrust deeper. Mugur eats Monas pussy again before penetrating her in spoons, slamming in vigorously until shes trembling with excitement. Mona orgasms again as Mugur fills her with hot cum, before he releases her from her restraints and embraces her tenderly. Hide

Sex Art - Lexi Dona - Dinner

File: wisuknasearlexdonwayg4xisgj.mp4
Size: 1.38 GB
Duration: 24:39
Resolution: 1920x1080
Format: mp4
Description: Sexy brunette Lexi Dona is preparing a romantic Dinner for her man while he lights the fire. As Andrej Lupins erotic movie begins, Ricky grabs his sweetheart from behind, the simmering chemistry between them evident. She abandons her attempt to serve up the food as he kisses her hungrily and caresses her breasts, then unzips her tight pants and slides a hand inside, fingering her to a rapid orgasm. They sit at the table to enjoy their meal but now its Lexi whos ravenous, pulling Rickys plate away and straddling his lap as she frees his hard cock from his jeans and jerks it vigorously. He follows her to the sofa and she wraps her lips around his erection for a sensuous blowjob, bobbing her head to suck it to the root and licking it lovingly. Theyre soon both naked and Lexi moves astride Ricky, impaling herself in cowgirl and riding energetically. She moves into a squat to bounce harder, her perfect ass rising and falling until another climax overwhelms her. Ricky flips her onto her back and drives deep, fucking her to a breathless orgasm and cumming over her trembling body. Hide

Sex Art - Alexa Flexy - Heavenly Passion

File: 2dmdanasearaleflewjoll84nfv.mp4
Size: 1.49 GB
Duration: 26:44
Resolution: 1920x1080
Format: mp4
Description: Gorgeous blonde Alexa Flexy and her boyfriend Tommy Gold lie sleeping in each others arms, as Andrej Lupins erotic movie Heavenly Passion begins. On awakening they kiss tenderly before Tommy slides down beneath the covers to lick his sweethearts shaved pussy, giving her a powerful orgasm. He caresses her beautiful breasts as she strokes and sucks his thick cock, then guides it into her and thrusts with mounting passion. Rolling over into cowgirl, Alexa rides sensually, breasts bouncing as she slides up and down her lovers rigid pole. She spins around into a sixty-nine, giving him a voracious blowjob while he licks her to another overwhelming climax. Switching to spoons, then back to missionary and lifting Alexas leg over his shoulder so he can drive deeper, Tommy strums her clit to intensify the sensations as he fucks her to another wild orgasm. She lies back and takes his cock between her lips again, encouraging him to thrust until he cums in her mouth and she gulps down his creamy load. Hide

Sex Art - Lilly Bella & Abela Sott - Tender Dream

File: 3umtpnasearlilabedhzmlomctj.mp4
Size: 1.40 GB
Duration: 25:09
Resolution: 1920x1080
Format: mp4
Description: Beautiful lovers Abela Sott and Lilly Bella are on the bed, kissing passionately, as Andrej Lupins erotic lesbian movie Tender Dream begins. Their hands roam in an avid embrace, undressing each other and caressing soft skin. Lilly sucks Abelas stiff... Read More

Sex Art - Mona Blue - Bound By Love Part 1

File: lh6jenasearmonblulbsctiqjh2.mp4
Size: 1.36 GB
Duration: 24:23
Resolution: 1920x1080
Format: mp4
Description: Cute blonde Mona Blue wins a game of Rock, Paper, Scissors against Mugur, but the objective of their contest is not so innocent. As episode one of Andrej Lupins erotic series Bound By Love begins, Mona binds Mugurs wrists to the arms of his chair and teases him by running her bare foot over his chest, then makes him watch as she masturbates. Trembling with arousal, the blue-eyed babe takes off her white panties and stuffs them in her lovers mouth, then unzips his jeans and wraps them around his stiff cock as she jerks it. A foot job drives him crazy, before she finally kneels to suck his dick sensuously. Straddling Mugur on the chair, Mona impales herself on his erection and rides hard, gazing into his eyes until shes overwhelmed by an intense orgasm. She spins around into reverse cowgirl, her perfect ass bouncing in Mugurs lap as she rides until they climax together before undoing his restraints. Its her turn to be bound now

Sex Art - Stacy Cruz - Colleague

File: jtj5gnasearstacru47rxetpzn9.mp4
Size: 1.49 GB
Duration: 26:23
Resolution: 1920x1080
Format: mp4
Description: Stunning brunette Stacy Cruz is having trouble with her computer, and asks her Colleague for help. But as Andrej Lupins erotic movie unfolds, Stacy finds herself growing increasingly aroused by her coworker's proximity lifting her tight skirt to reveal shes... Read More

Sex Art - Barbie Brill - Tease

File: a13yenasearbarbrilrh2dcmyso.mp4
Size: 1.23 GB
Duration: 22:02
Resolution: 1920x1080
Format: mp4
Description: Gorgeous Barbie Brill poses in sexy lingerie for Tommy Gold to sketch her. As Andrej Lupins erotic movie Tease begins, the cute blonde grows impatient, but her lover makes her wait before showing her the stick figure hes drawn! Barbie is not amused, but Tommy soon wins her over with his sweet kisses she straddles him, pulling down her lace bodysuit so he can suck her puffy nipples attentively. Unzipping Tommys pants, Barbie guides his stiff cock into her shaved pussy and slides up and down on it, increasing the pace until their bodies are slamming together vigorously. Tommy rolls Barbie over and eats her pussy before penetrating her in missionary and fucking her with powerful thrusts, strumming her clit to intensify the sensations until they orgasm together. His cum drips from her soaked pussy as they cling together, kissing through the afterglow of their passion. Hide

Sex Art - Claudia Bavel - Dimension

File: qobxwnasearclabavopu1zmk2id.mp4
Size: 1.32 GB
Duration: 23:58
Resolution: 1920x1080
Format: mp4
Description: Gorgeous Claudia Bavel is making out with Ricky in the shower, as Andrej Lupins erotic movie Dimension begins. She kneels to take his rigid cock in her mouth, sucking and jerking it eagerly so he groans with arousal. Claudia turns and leans against the tiled wall so Ricky can thrust into her from behind in a slow wipe transition we move to the bedroom to see the lovers on the bed, Claudias beautiful breasts jiggling in Rickys face as she rides him. She slides up and down his thick pole vigorously, her sexy ass rippling as he grabs and squeezes her cheeks, until they orgasm together. In another sequence they writhe together in spoons, Claudias gasps rising in pitch and volume as Ricky fucks her until they both cum again. Back in the shower, they reach new heights of passion, their drenched bodies slamming together to reach one more mutual climax.

Sex Art - Isabela De Laa - Lost In You

File: kba9inasearisadelaaa24jzzoyrn.mp4
Size: 1.37 GB
Duration: 24:37
Resolution: 1920x1080
Format: mp4
Description: Gorgeous brunette Isabela De Laa is a vision in sexy lingerie, responding passionately to Angelo Godshacks embrace. As Andrej Lupins erotic movie Lost In You begins, the lovers are on the bed, kissing voraciously. Angelo bares his sweethearts beautiful breasts and sucks her hard nipples, making her tremble with arousal, before continuing his way down, undressing her as he goes. He spreads her pussy open with his tongue and laps at her clit, then uses his fingers to drive her to the brink of orgasm.

Isabela is audibly drenched as Angelo thrusts his stiff cock into her and fucks her with powerful thrusts she clings to him as shes overwhelmed by one peak of pleasure after another. They move into spoons, Angelos fingers on Isabelas clit as he slams into her vigorously, then switch to cowgirl so she can ride at a gallop, her sexy ass bouncing frenetically. She climaxes again before jerking him off with intense focus, smiling as he cums for her.

Sex Art - Jessie Clark - My Insanity

File: 1bxmdnasearjesclaewfdjl9vdi.mp4
Size: 1.21 GB
Duration: 21:33
Resolution: 1920x1080
Format: mp4
Description: Cute brunette Jessie Clark quivers with arousal as Nick Ross runs his hands over her bare breasts. As Andrej Lupins erotic movie My Insanity begins, Nick squeezes Jesses soft flesh and toys with her stiff nipples, then slides a hand between her thighs to stroke her gently. Jessie peels off her panties and Nick fingerbangs her tenderly, giving her a breathless orgasm as she starts to jerk his hard cock. She straddles him, ponytail swishing and breasts jiggling in his face as she grinds on his erection and then impales herself on it.

Her sexy ass is reflected in the mirror as she rides passionately, sliding up and down Nicks thick pole until shes overwhelmed by another fierce climax. Jessie spins around into a sixty-nine and Nick licks her pussy while she sucks his cock and jerks his cum over her outstretched tongue. The sensual mood turns playful as the lovers wrestle and giggle, glowing with pleasure.

Sex Art - Milena Ray - Skin To Skin

File: zajt8nasearmilrayteta4wzfgx.mp4
Size: 1.24 GB
Duration: 22:13
Resolution: 1920x1080
Format: mp4
Description: Gorgeous brunette Milena Ray treats Tommy Gold to an erotic massage. As Andrej Lupins hot movie Skin To Skin begins, the naked beauty drizzles oil over her lovers back, then presses her sexy body against his. Tommy turns over so Milena can straddle him, gliding her bare pussy against his stiff cock as he caresses her nipples with slippery fingers, then sucks them avidly. She moves astride his face, then spins around into a sixty-nine so she can suck his cock voraciously as he licks her pussy, before impaling herself on his erection in reverse cowgirl. Milenas luscious ass rocks enticingly as she rides, switching to cowgirl so she can kiss Tommy passionately while the intense sensations drive her wild. After she has an explosive orgasm they switch to spoons, her toes pointing to the ceiling as Tommy slams into her vigorously. He rubs her clit to make her climax again before painting his cum over her mound of Venus as they lie in each others arms

Sex Art - Nata Ocean & Lili Charmelle - Guide To Pleasure

File: t3eeknasearnatlilvcxakoelhk.mp4
Size: 1.35 GB
Duration: 24:03
Resolution: 1920x1080
Format: mp4
Description: Cute girlfriends Lili Charmelle and Nata Ocean are having a candid chat about sex, as Andrej Lupins erotic lesbian movie Guide To Pleasure begins. Nata shows Lili her favorite vibrator and is soon giving her a demonstration, pressing the buzzing head against her panties to let her experience the arousing sensations. Lili doesnt hesitate when Nata peels off her panties and grinds the toy against her clit, adding two fingers in her drenched pussy to drive her wild. Getting naked, they kiss playfully before Nata frigs Lili to a mind-blowing orgasm, then goes down to lick her shaved pussy. Her pierced tongue soon gives Lili another, even more powerful climax. Now Nata lies back and Lili licks and fingerbangs her pussy eagerly, then uses the vibrator to make her orgasm utterly explosive.

Sex Art - Sofi Vega - Wistful Gaze

File: 5fnnynasearsofveggmrukudnus.mp4
Size: 1.38 GB
Duration: 24:56
Resolution: 1920x1080
Format: mp4
Description: Stunning Colombian model Sofi Vega enjoys her lovers Wistful Gaze as she teases him with her flirtatious body language. As Andrej Lupins erotic movie begins, the Black beauty unties her robe to bare her gorgeous breasts, then slides her lace panties down over her sexy bubble butt. Josh watches intently as Sofi masturbates, before she kisses him and invites him to lick all the way from her toes to her pussy. Josh drives her to boiling point with his tongue and fingers, and shes eager to reciprocate, sucking his thick cock avidly. Straddling Josh in cowgirl, Sofi impales herself on his erection and starts to ride, his hands squeezing her firm ass cheeks as she slides up and down until shes overwhelmed by an intense orgasm. Josh flips Sofi onto her back and thrusts into her in missionary, making her climax again as he fills her with hot cum.

Sex Art - Eva Brown - Barrier

File: t2li3nasearevabroosmrqazy5d.mp4
Size: 1.33 GB
Duration: 23:45
Resolution: 1920x1080
Format: mp4
Description: Gorgeous brunette Eva Brown is seductive in sexy lingerie and black stockings, her hands running over her voluptuous body. As Andrej Lupins erotic movie Barrier begins, shes separated from Ricky by a wall, but the sledgehammer-wielding stud and his paramour demolish it with powerful blows so they can be united. Ricky fondles Evas beautiful big breasts as they kiss hungrily, before she sinks to her knees, unzipping his jeans and sucking his stiff cock as it springs free. Eva leans against the wall and Ricky thrusts into her from behind, fucking her to an intense orgasm she turns and he fingerbangs her to one peak of pleasure after another. Eva gives her man another eager blowjob before he penetrates her again, her stockinged thigh wrapped around his waist. With vigorous strokes, he drives her to another orgasm before she uses both hands to jerk his cum all over her bare pussy.

Sex Art - Foxy Alissa & Sasha Krey - In The Clouds

File: fpwcknasearfoxsasq65dnn3zgv.mp4
Size: 1.29 GB
Duration: 23:06
Resolution: 1920x1080
Format: mp4
Description: Stunning brunette Foxy Alissa awakens her girlfriend with a tender caress. As Andrej Lupins erotic lesbian movie In The Clouds begins, Sasha Krey stirs in response to Foxys sweet kisses, moaning softly as her nipples stiffen against her lovers tongue. Foxy peels off Sashas white lace panties and snuggles up to her, rubbing her clit and thrusting two fingers into her audibly drenched pussy until she has a powerful orgasm. Now Foxy moves astride Sasha in a sexy sixty-nine so they can lick each other in unison Sasha soon becomes overwhelmed and climaxes again, before resuming her licking, driving Foxy to a blissful orgasmic peak. Foxy lies back and invites Sasha to lick and finger her juiced-up pussy until she orgasms again, then kisses the wetness from her lips as they cuddle up together in the drowsy afterglow of their lovemaking.

Sex Art - Carolina Savage - Show For One

File: 3txlenasearcarsav4d2sti7x9n.mp4
Size: 1.30 GB
Duration: 23:12
Resolution: 1920x1080
Format: mp4
Description: Gorgeous blonde Carolina Savage dances in sexy lingerie and stockings, as Andrej Lupins erotic movie Show For One begins. Charlie Dean watches appreciatively as the horny beauty strokes herself through her panties, then sucks on a dildo and eases it into her tight pussy. She masturbates to an intense orgasm before straddling Charlie on the bed so he can lick her hard nipples and squeeze her firm ass cheeks. Unzipping Charlies jeans, Carolina gazes up at him with her big blue eyes as she sucks his stiff cock voraciously, then moves astride him to ride cowgirl style. Her moans rise in pitch and volume as she fucks herself on Charlies dick, climaxing over and over. She licks her flavor from his erection before mounting him again in reverse cowgirl, her breasts jiggling as their bodies slam together. They switch to spoons, driving each other to a wild, sweaty simultaneous orgasm. Charlies cum seeps from his sweethearts soaked pussy as they kiss passionately, their hunger for each other still not assuaged.

Sex Art - Lili Charmelle - Sweet Moment

File: bhrbanasearlilchazvcposninh.mp4
Size: 1.41 GB
Duration: 25:09
Resolution: 1920x1080
Format: mp4
Description: Fresh from the shower, cute brunette Lili Charmelle sprays perfume onto her silky skin. As Andrej Lupins erotic movie Sweet Moment begins, the naked beauty joins Tommy Cabrio on the sofa, grinding on him and kissing him passionately, then straddling his face to get her bare pussy licked. Lilis eager to repay the oral favor, taking Tommys rigid cock between her lips and sucking it hungrily before spearing herself on it, cowgirl style. Her sexy ass bounces in Tommys lap as she rides sensuously, picking up the pace until they are slamming together frantically. Lili spins around into reverse cowgirl, rubbing her clit as she slides up and down Tommys thick shaft until her orgasm overwhelms her. Tommy keeps right on fucking her until they climax together, leaving them both so sweaty and sticky they return to the shower to continue the fun.

Sex Art - Ana Foxx - Girls Love Sex

File: 66stqnasearanafoxj7bfzcb74y.mp4
Size: 1.98 GB
Duration: 35:35
Resolution: 1920x1080
Format: mp4
Description: Stunning Black model Ana Foxx is the charming interviewee in the final instalment of Bo Llanberris Girls Love Sex series. The captivating American beauty talks to Bo and his hot redhead assistant Elle Alexandra, between arousing clips of her posing in sexy lingerie and high heels to show off her incredible long legs, then taking a shower and masturbating avidly. Shes joined by Will Pounder watch the previous episode to see gorgeous blonde Charlotte Stokely talking about setting up her boyfriend Will with Ana! who licks and fingers her pussy, driving her wild. Ana sucks Wills cock, then straddles him and rides it energetically, her perfect ass bouncing. They switch to doggy, missionary and then spoons, slamming together athletically until Will frosts Anas silky skin with his copious cum. Returning to the interview, Ana reveals that she has been making erotic movies for a decade, and knows exactly what she likes. She is bisexual and polyamorous, and gives great sex advice as well as great blowjobs! Candid and funny, shes a joy to get to know better.

Sex Art - Nata Ocean - Harvest

File: ksn6pnasearnatoceyeuefsysg2.mp4
Size: 1.02 GB
Duration: 18:18
Resolution: 1920x1080
Format: mp4
Description: Cute brunette Nata Ocean raps on the window to get the attention of her boyfriend. As Andrej Lupins erotic movie Harvest begins, Tommy Gold is picking apples, but his sweetheart tempts him to come indoors with a sexy striptease. Dropping the fruit on the table, Tommy sprawls on the sofa and grabs Natas firm round ass as she kisses him. Nata undresses her lover hastily and starts to suck his cock, her lips sliding up and down his thick shaft as she bobs her head eagerly.

Straddling him, she skewers herself on his erection in cowgirl and rides vigorously, rocking her hips and bouncing hard. Tommy lifts Nata, still impaled on his cock, and flips her onto her back, driving into her in missionary. He fucks her with powerful strokes before licking her shaved pussy until she has an intense orgasm. Shes still quivering as he penetrates her in spoons, his fingers on her clit to intensify the sensations. Nata enjoys peak after peak of pleasure, climaxing again as Tommy fills her with hot cum that floods out of her drenched pussy as they kiss through the afterglow.