Posts matching the tag: Sex Art

Sex Art - Zlata Shine & Helina Dream - Focus

File: apyvxnasearzlahell2rqvrb4q3.mp4
Size: 1.44 GB
Duration: 25:42
Resolution: 1920x1080
Format: mp4
Description: Gorgeous girlfriends Helina Dream and Zlata Shine are giving each other their undivided attention, as Andrej Lupins erotic lesbian movie Focus begins. Statuesque blonde Zlata presses her sweetheart against the mirror and caresses her seductively, undressing her and fondling her breasts while watching her reflection to enjoy her reaction. Getting naked and pushing Helina onto the bed, Zlata sucks her nipples voraciously, then moves between her slender thighs to lick her shaved pussy, driving her wild. They move into spoons and Zlata fingerbangs Helina to a powerful orgasm. Now Helina takes control, lavishing licks on Zlatas beautiful breasts, frigging her drenched pussy and lapping at her clit until shes overwhelmed by an intense climax.

Sex Art - Molly Devon - Right Timing

File: 211htnasearmoldev4vb5oe9qqb.mp4
Size: 1.48 GB
Duration: 26:26
Resolution: 1920x1080
Format: mp4
Description: Cute blonde Molly Devon is still sleepy as she makes her morning tea. As Andrej Lupins erotic movie Right Timing begins, Charlie Dean wants to ensure her day gets off to a perfect start, but as he embraces her tenderly, their roommate arrives home and interrupts them. By the time he leaves, the lovers cant keep their hands off each other. Charlie caresses Mollys beautiful breasts and slides a hand into her panties to stroke her. Getting her naked, he bends her over the table and eats her pussy from behind, then tugs down his sweatpants to let his impressive erection spring free. He penetrates Molly doggy style, holding still to let her fuck herself on his thick shaft before he starts to thrust. They switch to missionary, Mollys long legs splayed so Charlie can drive deep and hard, strumming her clit until an intense orgasm makes her back arch in ecstasy. Charlie lifts her, still impaled on his dick, and sits on the sofa so she can ride him cowgirl style. Molly climaxes again and again as they slam together and Charlie fills her with hot cum that drips out as they kiss breathlessly.

Sex Art - Casey - Tempt You

File: 2n57znasearcasefmhlmlf8zn.mp4
Size: 1.38 GB
Duration: 24:34
Resolution: 1920x1080
Format: mp4
Description: Gorgeous blonde Casey is irresistible in a sexy black dress, dancing for Nick Ross, as Andrej Lupins erotic movie Tempt You begins. She rocks her hips, wiggling her ass and caressing her beautiful breasts as Nick watches appreciatively. When Casey joins Nick on the sofa, he kisses her passionately and lavishes attention on her stiff nipples as he undresses her. She straddles his face to get her pussy licked, then unzips his jeans and sucks his rigid cock eagerly.

Moving astride him, Casey impales herself on his thick shaft and rides it vigorously, breasts bouncing and ass cheeks rippling as she slides up and down until shes overwhelmed by an intense orgasm. She turns around into reverse cowgirl, fucking herself on Nicks erection and climaxing again before they switch to missionary. Now Nick takes control, gazing into Caseys eyes as he thrusts into her they move into spoons so she can rub her clit as he makes her orgasm again and again. Her final climax triggers his own, and he fills her pussy with hot cum that trickles out as they lie wrapped in each others arms.

Sex Art - Alexis Crystal & Ryana - Fondness

File: wun1fnasearalerya21o7ftwdxa.mp4
Size: 1.37 GB
Duration: 24:45
Resolution: 1920x1080
Format: mp4
Description: Cute girlfriends Alexis Crystal and Ryana are relaxing at home together, as Andrej Lupins erotic lesbian movie Fondness begins. Ryana is reading while Alexis snaps selfies, then strips down to her sexy lingerie and starts to touch herself provocatively. She wraps her arms around her sweetheart, kissing her neck and fondling her beautiful big breasts adoringly. Pushing her voluptuous lover onto the sofa, Alexis lavishes attention on her stiff nipples before moving between her spread thighs.

She nuzzles Ryanas fluffy bush and spreads her pussy lips like butterfly wings, licking and sucking voraciously. Alexis goes face down ass up and Ryana eats her pussy from behind, then licks her clit while fingering her to a mind-blowing orgasm. Alexis takes a moment to catch her breath before resuming her worship of Ryanas breasts while frigging her to an intense climax.

Sex Art - Ivy Rein - Be Complete

File: hatsnnasearivyrei1j4sbevvbo.mp4
Size: 1.48 GB
Duration: 26:30
Resolution: 1920x1080
Format: mp4
Description: Stunning blonde Ivy Rein is lying on the bed, running her hands over her sexy body, as Andrej Lupins erotic movie Be Complete begins. As she masturbates sensuously, shes joined by Charlie Dean, who tugs her panties aside and licks her shaved pussy, giving her a powerful orgasm. Moving between Ivys slender thighs, Charlie penetrates her in missionary, gazing into her eyes as he thrusts with slow intensity. She hooks a leg over his shoulder so he can go deep, strumming her clit to make her gasp and moan with arousal. Ivy licks Charlies long cock from root to tip, then wraps her lips around it and sucks voraciously. She straddles him in cowgirl, impaling herself on his thick shaft and riding vigorously while he sucks her puffy nipples until shes overwhelmed by another climax. They pick up the pace, slamming together wildly, then switch to spoons, wave after wave of orgasm sweeping through Ivys trembling body before Charlie fills her with hot cum that trickles out as they kiss, breathless and glowing with pleasure.

Sex Art - Kristy Waterfall - Sweet Night

File: alzflnasearkriwatsmgdz7kufc.mp4
Size: 1.42 GB
Duration: 25:06
Resolution: 1920x1080
Format: mp4
Description: Cute blonde Kristy Waterfall is lying on the bed in Rickys arms, as Andrej Lupins erotic movie Sweet Night begins. He strokes her through her pajamas as they kiss passionately she straddles him, letting her beautiful big breasts bounce free and grinding in his lap. Kristy kisses her way down, peeling off Rickys briefs as she goes, and licks the tip of his rigid cock playfully as she undresses. Guiding it inside, she rides in an energetic cowgirl, her boobs jiggling against Rickys palms as she slides up and down vigorously.

Ricky flips her onto her back and licks her shaved pussy, then rolls her over to fuck her doggy style. Kristy moans with arousal as Ricky slides into her from behind, making her luscious ass ripple with every thrust. They switch to spoons and he drives her to an intense orgasm before glazing her soaked pussy with his cum.

Sex Art - Lady Dee & Lovita Fate - Backlight

File: tbehonasearladlov8akqkjx44o.mp4
Size: 1.16 GB
Duration: 20:40
Resolution: 1920x1080
Format: mp4
Description: Cute blonde Lovita Fate and raven-haired beauty Lady Dee are kissing passionately, as Andrej Lupins erotic lesbian movie Backlight begins. The lovers gaze into each others eyes as their hands wander amorously, squeezing and fondling. Dee nips Lovitas stiff nipples through her sweater, and slides a hand into her white lace panties to stroke her to a breathless orgasm. Stripping Lovita naked, Dee licks her shaved pussy eagerly, then fingerbangs her until she climaxes again in a flurry of gasps and cries.

She turns onto her knees and Dee frigs her from behind, giving her one more orgasm, then trades places so Lovita can eat her pussy just as voraciously. She adds her fingers to the mix, making Dee climax twice before they resume their sweet kisses, their tender smiles saying they are both utterly sated.

Sex Art - Dominique Furr - Say You Do

File: r86punaseardomfur81i3bbbb5p.mp4
Size: 968.82 MB
Duration: 17:06
Resolution: 1920x1080
Format: mp4
Description: Gorgeous Dominique Furr enjoys animated pillow talk with Tommy Cabrio, as Andrej Lupins erotic movie Say You Do begins. But actions speak louder than words, and the raven-haired cutie takes her lovers hand and places it on her breasts as she kisses him tenderly. Tommy strokes Dominiques shaved pussy before penetrating her in missionary, gazing into her eyes as he thrusts slowly and sensuously. He fondles her big breasts and she strums her clit to intensify the sensations, trembling with arousal. They roll over into cowgirl, Dominiques tits jiggling in Tommys face as she rides to a powerful orgasm. She keeps bouncing until Tommy cums too, his hot load dripping out as they kiss through the afterglow of their lovemaking.

Sex Art - Bella Angel - Crazy Moments

File: dsbmenasearbelangbwh6yse6yu.mp4
Size: 1.36 GB
Duration: 24:09
Resolution: 1920x1080
Format: mp4
Description: Cute Bella Angel and her boyfriend Ricky check themselves out in the full-length mirror, as Andrej Lupins erotic movie Crazy Moments begins. They kiss and cuddle playfully, giggling as Ricky lifts Bellas sweater and fondles her lovely breasts, then pulls down her panties and grabs her sexy ass. He turns her around and thrusts into her from behind, so they can watch themselves as he fucks her vigorously. Bella pushes Ricky onto the bed and wraps her mouth around his rigid cock, gazing up at him as she sucks it.

Straddling him, she impales herself on it cowgirl style, her breasts bouncing as she rides. Ricky rolls her onto her back and powers into her she lifts her legs over his shoulders so he can drive deeper, making her gasp and moan with pleasure. Switching to doggy, the lovers slam together until Bella is overwhelmed by an intense orgasm. Ricky gives her a moment to catch her breath before he resumes thrusting, returning to missionary to make her climax again as he fills her pussy with hot cum.

Sex Art - Charlie Nice & Lilly Bella - Wake Up And Love

File: r7wlbnasearchalil3xbugemrpl.mp4
Size: 1.31 GB
Duration: 23:28
Resolution: 1920x1080
Format: mp4
Description: Gorgeous Lilly Bella starts her morning with a shower, leaving her girlfriend sleeping. But as Andrej Lupins erotic lesbian movie Wake Up And Love begins, Lilly returns to bed, where cute Charlie Nice greets her with a sleepy kiss. Their embrace quickly grows passionate as Lilly slips a hand into her sweethearts panties, sucking her hugely erect nipples to intensify the stimulating sensations. She peels off the skimpy panties and licks Charlies shaved pussy voraciously, thrusting two fingers between her slippery folds to drive her to a powerful orgasm.

Charlie rolls over and Lilly frigs her from behind, making her climax again, then straddles her face to get her own pussy licked. She rides Charlies tongue, her pierced nipples jiggling as wave after wave of pleasure floods through her body. Charlie fingerbangs Lilly to another overwhelming orgasm and cuddles her though the afterglow, the perfect start to their day.

Sex Art - Alexis Crystal - Seasons Episode 2

File: msn5onasearalecryew6antq8e6.mp4
Size: 1.32 GB
Duration: 23:28
Resolution: 1920x1080
Format: mp4
Description: Gorgeous Alexis Crystal walks through the snowy landscape, the wind catching her sheer white gown, as episode two Winter of Andrej Lupins erotic series Seasons begins. Falling back into the deep snow, shes transported into a soft white room as Nick Ross catches her in his arms and embraces her passionately. He sucks her stiff nipples, then kisses his way down between her stockinged thighs to lick her pussy, before fingering her to the brink of orgasm. Nick penetrates Alexis in spoons, then switches to missionary, fucking her with steady strokes until her climax overwhelms her. They move into doggy position and Nick drives into Alexis from behind, making her orgasm again and filling her with hot cum that gushes out as they kiss tenderly.

Sex Art - Antonia Sainz - Change Of Mind

File: rlizonasearantsaivoif1bdkb7.mp4
Size: 1.38 GB
Duration: 24:41
Resolution: 1920x1080
Format: mp4
Description: Sexy brunette Antonia Sainz is in a rush to drink her morning coffee and get to work, but Nick Ross knows how to give her a Change Of Mind. As Andrej Lupins erotic movie begins, Nick grabs his sweethearts curvaceous ass and kisses her neck. She pushes him away, but soon relents and wraps her arms around him, rubbing his crotch and then unzipping his jeans and jerking his rigid cock.

Nick unbuttons Antonias shirt and fondles her beautiful big breasts, tugging her nipples playfully pulling down her panties and bending her over the kitchen counter, he thrusts into her from behind and fucks her to a breathless orgasm, her breasts bouncing and booty rippling with every stroke. Antonia kneels and takes Nicks cock in her mouth, gazing up at him as she sucks it eagerly, then she hops up onto the counter and he licks her pussy until shes gasping and moaning with every flick of his tongue. He penetrates her again, sucking her nipples and fucking her to one blissful peak after another. Wrapping her soft breasts around his shaft, Antonia titty-fucks Nick until his cum jets out all over her creamy cleavage.

Sex Art - Kaira Love & Ryana - Made A Star

File: qloqynasearkairyafz9i8s4qbv.mp4
Size: 1.20 GB
Duration: 21:31
Resolution: 1920x1080
Format: mp4
Description: Cute redhead Kaira Love is shooting a video of her sexy girlfriend Ryana, as Andrej Lupins erotic lesbian movie Made A Star begins. Ryana poses provocatively, exposing the neat bush that adorns her mound of Venus, and fondling her beautiful big breasts. Filming Ryana masturbating gets Kaira aroused too, and she doesnt hesitate when the busty blonde invites her to come closer. They kiss hungrily, Ryana squeezing her sweethearts ass through her tight jeans before tugging them down.

When she has Kaira perfectly naked, Ryana sucks her nipples and licks her shaved pussy, thrusting two fingers into her hot slot to drive her wild. Kaira has an intense orgasm, taking a moment to catch her breath before grinding on Ryanas soft thigh while frigging her to a powerful climax. The phones camera is still capturing every moment as they move into scissors, mashing their wet pussies together until they orgasm in unison, the perfect ending to their hot home movie.

Sex Art - Carolina Savage - Your Touch

File: evyygnasearcarsavkptfppvlyg.mp4
Size: 1.39 GB
Duration: 25:03
Resolution: 1920x1080
Format: mp4
Description: Sexy blonde Carolina Savage is in bed with Tommy Gold, their hands exploring amorously. As Andrej Lupins erotic movie Your Touch begins, the lovers kiss tenderly Tommy lifts his sweethearts sweater and sucks her stiff nipples as she grinds on the growing bulge in his briefs. Kissing his way down, Tommy licks Carolina through her panties, then peels them off and eats her shaved pussy until shes moaning and quivering with pleasure.

He penetrates her in missionary and fucks her to an orgasm shes eager to taste herself on his dick, licking it from root to tip before wrapping her lips around it for an intense blowjob. Straddling Tommy, Carolina rides him cowgirl style, wave after wave of bliss sweeping through her beautiful body. They switch to spoons, slamming together until Carolina orgasms again as Tommy fills her pussy with hot cum.

Sex Art - Abela Sott - Stop Talking

File: yvchtnasearabesotvplxjiiuny.mp4
Size: 1.24 GB
Duration: 22:25
Resolution: 1920x1080
Format: mp4
Description: Cute Abela Sott is flirting and chatting with Ricky, until she decides its time to Stop Talking and show her lover what she wants. As Andrej Lupins erotic movie begins, the sexy blonde undresses, then unzips Rickys jeans and sucks his stiff cock between eager kisses. She straddles his lap and grinds on his erection, teasing him further by dismounting and masturbating as he watches and does likewise. Unable to resist any longer, Ricky licks and fingerbangs Abelas drenched pussy, giving her an intense orgasm.

Now she moves astride him again, impaling herself on his rigid dick and sliding up and down until the powerful sensations overwhelm her. Ricky flips Abela onto her back and thrusts into her in missionary, her legs over his shoulders so he can fuck her deep and hard. She orgasms again and jerks his hot cum over her trembling body.

Sex Art - Jayla De Angelis - French Charm

File: pjsa4nasearjaydeangfrlp6jfe3y.mp4
Size: 1.36 GB
Duration: 24:03
Resolution: 1920x1080
Format: mp4
Description: Gorgeous Spanish blonde Jayla De Angelis is won over by Joshs French Charm as they flirt in his native language. As Andrej Lupins erotic movie begins, they share a romantic kiss she straddles his lap, untying the halter neck of her dress to expose her beautiful breasts, and he caresses them appreciatively. Jayla unzips her lovers jeans and licks his stiff cock from root to tip as the prelude to a sensual blowjob. Josh licks Jaylas shaved pussy, making her moan with arousal, then penetrates her in missionary and fucks her to an intense orgasm. They switch to doggy, Jayla slamming her sexy ass back to meet Joshs thrusts she moves astride him in a reverse cowgirl squat and rides vigorously, her breasts bouncing and her fingers on her clit. She has another powerful climax before Josh fills her pussy with creamy cum that drips out as they kiss adoringly.

Sex Art - Nata Ocean - Living It Up

File: sdmb8nasearnatocezeeqgbzukd.mp4
Size: 1.28 GB
Duration: 22:37
Resolution: 1920x1080
Format: mp4
Description: Cute brunette Nata Ocean distracts Tommy Gold from his work, as Andrej Lupins erotic movie Living It Up begins. She kisses him as she grinds in his lap, then peels off her sweater dress so he can squeeze her sexy ass through her pantyhose. Nata unzips Tommys pants, pulls down her nylons and panties and impales herself on his erection in reverse cowgirl. She slides up and down sensuously, bouncing more and more vigorously until shes overwhelmed by a powerful orgasm. Now Tommy bends Nata over and fucks her from behind, fondling her breasts and rubbing her clit to make her climax again. They switch to spoons, rocking together energetically until Natas most intense orgasm is triggered as Tommy fills her pussy with hot cum.

Sex Art - Sky Pierce - Whisper To You

File: pgtspnasearskypiepa4ysfqb7s.mp4
Size: 1.38 GB
Duration: 24:42
Resolution: 1920x1080
Format: mp4
Description: Gorgeous blonde Sky Pierce murmurs seductively into Nek Sinners ear, as Andrej Lupins erotic movie Whisper To You begins. She rubs his crotch as she tells him what she has in store for him, then straddles him and takes off her top so he can suck her nipples. Unzipping Neks pants, Sky engulfs his rigid cock in her mouth for a sensual blowjob, pausing to get naked and tease him with more dirty talk. She moves astride him, impaling herself and riding cowgirl style until an intense orgasm sweeps through her slender body. Nek licks Skys shaved pussy to make her climax again, then penetrates her in missionary, his powerful thrusts driving her wild. They switch to doggy, Neks fingers on Skys clit to give her another orgasm as he cums inside her creamy pussy.

Sex Art - Jessie Clark - Love Haze

File: xe5zhnasearjesclawemr98sr7e.mp4
Size: 1.22 GB
Duration: 21:50
Resolution: 1920x1080
Format: mp4
Description: The day gets off to a sexy start for gorgeous brunette Jessie Clark and her boyfriend, Ricky. As Andrej Lupins erotic movie Love Haze begins, the lovers make sizzling eye contact across the room, and Jessie opens her silk robe to display more of her ample cleavage. Ricky makes it clear hes enjoying the show as his sweetheart starts to caress her beautiful breasts. He joins her on the sofa, kissing and caressing her tenderly while she strokes the stiff dick thats tenting his shorts. Ricky lavishes attention on Jessies breasts, then licks her pussy, giving her a powerful orgasm. They hurry to get naked, and Ricky thrusts into Jessie, first in missionary and then in spoons, their bodies slamming together as he fucks her vigorously. Jessie climaxes again before sucking her wetness from Rickys rigid cock, her sensual blowjob making him gasp with arousal. She skewers herself on his erection in reverse cowgirl, her cute ass bouncing and her breasts jiggling wildly as she rides to another orgasm, then jerks out his hot cum as they kiss adoringly.

Sex Art - Lee Anne - Endless Love

File: tnbc3nasearleeannzt64c9lx7s.mp4
Size: 1.14 GB
Duration: 20:35
Resolution: 1920x1080
Format: mp4
Description: Gorgeous brunette Lee Anne smiles with sensual pleasure at Michael Flys tender embrace. As Andrej Lupins erotic movie Endless Love begins, Michaels hands roam, undressing his sweetheart and massaging lotion into her silky skin. He caresses Lee Annes perfect ass, then slides a hand between her thighs to stroke her pussy, making her moan with arousal. Lee Anne unzips Michaels pants and guides his stiff cock into her tight slot in spoons, rocking her sexy ass back to meet his vigorous thrusts. She rubs her clit as he fucks her to a powerful orgasm, then straddles him in cowgirl and rides until shes overwhelmed by another, even more intense one. When shes caught her breath, Michael resumes thrusting until they climax together, then cuddle through the afterglow of their lovemaking.Hide

Sex Art - Mona Blue - Bound By Love Part 2

File: qxhhanasearmonbluxcfdedwjga.mp4
Size: 1008.51 MB
Duration: 17:32
Resolution: 1920x1080
Format: mp4
Description: Its cute blonde Mona Blues turn to be restrained, in episode two of Andrej Lupins erotic series Bound By Love. The naked beautys wrists are strapped to the chair while Mugur sucks her nipples, making her squirm with arousal. He licks a trail down to her pussy, lapping at her clit and sliding his fingers into her juicy slot. Just as Mona starts to orgasm, Mugur replaces his fingers with his rigid cock, driving her wild. He fucks her to another climax, lifting her legs onto his shoulders so he can thrust deeper. Mugur eats Monas pussy again before penetrating her in spoons, slamming in vigorously until shes trembling with excitement. Mona orgasms again as Mugur fills her with hot cum, before he releases her from her restraints and embraces her tenderly. Hide

Sex Art - Lexi Dona - Dinner

File: wisuknasearlexdonwayg4xisgj.mp4
Size: 1.38 GB
Duration: 24:39
Resolution: 1920x1080
Format: mp4
Description: Sexy brunette Lexi Dona is preparing a romantic Dinner for her man while he lights the fire. As Andrej Lupins erotic movie begins, Ricky grabs his sweetheart from behind, the simmering chemistry between them evident. She abandons her attempt to serve up the food as he kisses her hungrily and caresses her breasts, then unzips her tight pants and slides a hand inside, fingering her to a rapid orgasm. They sit at the table to enjoy their meal but now its Lexi whos ravenous, pulling Rickys plate away and straddling his lap as she frees his hard cock from his jeans and jerks it vigorously. He follows her to the sofa and she wraps her lips around his erection for a sensuous blowjob, bobbing her head to suck it to the root and licking it lovingly. Theyre soon both naked and Lexi moves astride Ricky, impaling herself in cowgirl and riding energetically. She moves into a squat to bounce harder, her perfect ass rising and falling until another climax overwhelms her. Ricky flips her onto her back and drives deep, fucking her to a breathless orgasm and cumming over her trembling body. Hide

Sex Art - Alexa Flexy - Heavenly Passion

File: 2dmdanasearaleflewjoll84nfv.mp4
Size: 1.49 GB
Duration: 26:44
Resolution: 1920x1080
Format: mp4
Description: Gorgeous blonde Alexa Flexy and her boyfriend Tommy Gold lie sleeping in each others arms, as Andrej Lupins erotic movie Heavenly Passion begins. On awakening they kiss tenderly before Tommy slides down beneath the covers to lick his sweethearts shaved pussy, giving her a powerful orgasm. He caresses her beautiful breasts as she strokes and sucks his thick cock, then guides it into her and thrusts with mounting passion. Rolling over into cowgirl, Alexa rides sensually, breasts bouncing as she slides up and down her lovers rigid pole. She spins around into a sixty-nine, giving him a voracious blowjob while he licks her to another overwhelming climax. Switching to spoons, then back to missionary and lifting Alexas leg over his shoulder so he can drive deeper, Tommy strums her clit to intensify the sensations as he fucks her to another wild orgasm. She lies back and takes his cock between her lips again, encouraging him to thrust until he cums in her mouth and she gulps down his creamy load. Hide

Sex Art - Lilly Bella & Abela Sott - Tender Dream

File: 3umtpnasearlilabedhzmlomctj.mp4
Size: 1.40 GB
Duration: 25:09
Resolution: 1920x1080
Format: mp4
Description: Beautiful lovers Abela Sott and Lilly Bella are on the bed, kissing passionately, as Andrej Lupins erotic lesbian movie Tender Dream begins. Their hands roam in an avid embrace, undressing each other and caressing soft skin. Lilly sucks Abelas stiff... Read More

Sex Art - Mona Blue - Bound By Love Part 1

File: lh6jenasearmonblulbsctiqjh2.mp4
Size: 1.36 GB
Duration: 24:23
Resolution: 1920x1080
Format: mp4
Description: Cute blonde Mona Blue wins a game of Rock, Paper, Scissors against Mugur, but the objective of their contest is not so innocent. As episode one of Andrej Lupins erotic series Bound By Love begins, Mona binds Mugurs wrists to the arms of his chair and teases him by running her bare foot over his chest, then makes him watch as she masturbates. Trembling with arousal, the blue-eyed babe takes off her white panties and stuffs them in her lovers mouth, then unzips his jeans and wraps them around his stiff cock as she jerks it. A foot job drives him crazy, before she finally kneels to suck his dick sensuously. Straddling Mugur on the chair, Mona impales herself on his erection and rides hard, gazing into his eyes until shes overwhelmed by an intense orgasm. She spins around into reverse cowgirl, her perfect ass bouncing in Mugurs lap as she rides until they climax together before undoing his restraints. Its her turn to be bound now

Sex Art - Stacy Cruz - Colleague

File: jtj5gnasearstacru47rxetpzn9.mp4
Size: 1.49 GB
Duration: 26:23
Resolution: 1920x1080
Format: mp4
Description: Stunning brunette Stacy Cruz is having trouble with her computer, and asks her Colleague for help. But as Andrej Lupins erotic movie unfolds, Stacy finds herself growing increasingly aroused by her coworker's proximity lifting her tight skirt to reveal shes... Read More

Sex Art - Barbie Brill - Tease

File: a13yenasearbarbrilrh2dcmyso.mp4
Size: 1.23 GB
Duration: 22:02
Resolution: 1920x1080
Format: mp4
Description: Gorgeous Barbie Brill poses in sexy lingerie for Tommy Gold to sketch her. As Andrej Lupins erotic movie Tease begins, the cute blonde grows impatient, but her lover makes her wait before showing her the stick figure hes drawn! Barbie is not amused, but Tommy soon wins her over with his sweet kisses she straddles him, pulling down her lace bodysuit so he can suck her puffy nipples attentively. Unzipping Tommys pants, Barbie guides his stiff cock into her shaved pussy and slides up and down on it, increasing the pace until their bodies are slamming together vigorously. Tommy rolls Barbie over and eats her pussy before penetrating her in missionary and fucking her with powerful thrusts, strumming her clit to intensify the sensations until they orgasm together. His cum drips from her soaked pussy as they cling together, kissing through the afterglow of their passion. Hide

Sex Art - Claudia Bavel - Dimension

File: qobxwnasearclabavopu1zmk2id.mp4
Size: 1.32 GB
Duration: 23:58
Resolution: 1920x1080
Format: mp4
Description: Gorgeous Claudia Bavel is making out with Ricky in the shower, as Andrej Lupins erotic movie Dimension begins. She kneels to take his rigid cock in her mouth, sucking and jerking it eagerly so he groans with arousal. Claudia turns and leans against the tiled wall so Ricky can thrust into her from behind in a slow wipe transition we move to the bedroom to see the lovers on the bed, Claudias beautiful breasts jiggling in Rickys face as she rides him. She slides up and down his thick pole vigorously, her sexy ass rippling as he grabs and squeezes her cheeks, until they orgasm together. In another sequence they writhe together in spoons, Claudias gasps rising in pitch and volume as Ricky fucks her until they both cum again. Back in the shower, they reach new heights of passion, their drenched bodies slamming together to reach one more mutual climax.

Sex Art - Isabela De Laa - Lost In You

File: kba9inasearisadelaaa24jzzoyrn.mp4
Size: 1.37 GB
Duration: 24:37
Resolution: 1920x1080
Format: mp4
Description: Gorgeous brunette Isabela De Laa is a vision in sexy lingerie, responding passionately to Angelo Godshacks embrace. As Andrej Lupins erotic movie Lost In You begins, the lovers are on the bed, kissing voraciously. Angelo bares his sweethearts beautiful breasts and sucks her hard nipples, making her tremble with arousal, before continuing his way down, undressing her as he goes. He spreads her pussy open with his tongue and laps at her clit, then uses his fingers to drive her to the brink of orgasm.

Isabela is audibly drenched as Angelo thrusts his stiff cock into her and fucks her with powerful thrusts she clings to him as shes overwhelmed by one peak of pleasure after another. They move into spoons, Angelos fingers on Isabelas clit as he slams into her vigorously, then switch to cowgirl so she can ride at a gallop, her sexy ass bouncing frenetically. She climaxes again before jerking him off with intense focus, smiling as he cums for her.