Download Porn Videos for Free from Rapidgator | PornRapidgator.com

X

Loading image...

Home

Go Premium

Home

X

Go Premium

Posts matching the tag: All Internal

All Internal - Milena Devi - The Back Region Of Milena

File: 7fym4naalinmildevfm1skinmdd.mp4

Size: 961.17 MB

Duration: 50:29

Resolution: 960x540

Format: mp4

Description: The back region of Milena Devi is simply just, yums. No wonder we could not resist to ask one of our guys to put that dick in that tight little hole of hers. The pussy also looks delicious! However this time, it was all about that ass, and that internal explosion that guy produced.

Aug 17, 2019

All Internal - Mila Fox - Mila Takes A Cock Right Up Her Ass

File: vwhxmnaalinmilfoxtyg9ne5oks.mp4

Size: 888.61 MB

Duration: 46:46

Resolution: 960x540

Format: mp4

Description: Mila Fox takes a cock right up her ass, and our guy Renato had a really hard time not to cum instantly seeing that sweet girl next door type of body of hers. Well, it happened later, inside that butt, just for us to witness nice hot dripping cum all over the place.

Aug 12, 2019

All Internal - Emma Fantasy - Emma Has A Tight Body

File: 1smlwnaalinemmfan4au3cbftp3.mp4

Size: 1.05 GB

Duration: 56:19

Resolution: 960x540

Format: mp4

Description: Emma Fantasy has a tight body, including her anal region, which just begs for a nice filling of dick. Renato did his best with this little bombarder and filled her up well, the results are quite tempting in the form of dripping sperm from her ass.

Aug 02, 2019

All Internal - Mia Split - Russian Slim Babe Mia

File: dxom3naalinmiasplndgqvg2a8e.mp4

Size: 989.68 MB

Duration: 51:34

Resolution: 960x540

Format: mp4

Description: Russian slim babe Mia Split DOES splitting... Her legs are living their own lifes basicaly. Very rare to see such an athletic beauty, who also loves to fuck that much. She got that dick all up in her butt, and the finish was a fulfilling protein filled creampie, which should be part of all similar type girls diets we believe, to keep them fit and healthy!

Jul 23, 2019

All Internal - Alyssa Reece - Alyssa First Anal Scene Is Finally Out

File: txdl2naalinalyreekykiwlvvyn.mp4

Size: 878.53 MB

Duration: 46:28

Resolution: 960x540

Format: mp4

Description: Here is an exlusive World premiere for all of your excitement! Alyssa Reeces first anal scene is finally out, she took that dick so deep, so that said dick could explode inside that ass of hers very well Enjoy this rarity, so as we did making it possible for you to watch!

Jul 13, 2019

All Internal - Stacy Bloom - Juicy Babe Stacy Got Her Ass Ripped Off

File: yevlfnaalinstablob3y9q3viy9.mp4

Size: 984.53 MB

Duration: 51:52

Resolution: 960x540

Format: mp4

Description: Juicy babe Stacy Bloom got her ass ripped off, after some visit into her hairy pussy of course. Her tits were jumping up and down, whilst our guy filled her ass with dripping, hot messy cum.

Jul 08, 2019

All Internal - Meri Kris - Tall Meri With Her Slim Fit Body

File: 77dcunaalinmerkriceekdhmywp.mp4

Size: 978.65 MB

Duration: 51:25

Resolution: 960x540

Format: mp4

Description: Tall Meri Kris with her slim fit body and long black hair gets the anal sex of her life, punded deeply, and it ends with a dripping messy creampie as well. We hope to see her again soon

Jul 04, 2019

All Internal - Sofia Like - Blue-eyed Brunette Babe

File: ycceynaalinsoflikf7ssulxpdd.mp4

Size: 844.27 MB

Duration: 44:16

Resolution: 960x540

Format: mp4

Description: Blue-Eyed brunette babe Sofia Like gets her round little butt sodomized by our lucky stud in every which way until he shoots his load deep inside of her anal cavity. Enjoy!

Jul 03, 2019

All Internal - Diane Chrystall - Diane With Her Vibrant White Skin

File: gtqywnaalindiachrbstxw4iyi4.mp4

Size: 1.14 GB

Duration: 01:42

Resolution: 960x540

Format: mp4

Description: Diane Chrystall with her vibrant white skin looks like an innocent shy someone at first, but trust us, she is not. One hour of classic pussy pounding with hardcore elements. She is filled up real good at the end!

Jun 18, 2019

All Internal - Alyssa Reece & Nikki Hill - A Perfectly Synced Pair

File: utglrnaalinalyniknmngsrwisz.mp4

Size: 1.05 GB

Duration: 56:31

Resolution: 960x540

Format: mp4

Description: No Description Available

Jun 08, 2019

All Internal - Sarah Cute - Oh My God

File: 2nlpjnaalinsarcutxpvbhq6ef9.mp4

Size: 965.17 MB

Duration: 50:36

Resolution: 960x540

Format: mp4

Description: Oh my god, look at those tits on Sarah Cute! Wow! Anyways, she came by for a casual session of hardcore anal sex and a load of sperm. Both achieved

May 29, 2019

All Internal - Helena Moeller - German Precision

File: nhtwfnaalinhelmoe1eaxafknxl.mp4

Size: 400.88 MB

Duration: 49:40

Resolution: 720x400

Format: mp4

Description: German precision very well there in this scene with Helena Moeller, she precisely took that cock , deep inside her ass, just to give an example. A nice hottie in a great scene, ending in a great, messy, dripping creampie!

May 14, 2019

All Internal - Alexa Sexy - Hot Alexa Debuts With This Scene

File: cq7knnaalinalesexgafptxriyp.mp4

Size: 969.92 MB

Duration: 50:40

Resolution: 960x540

Format: mp4

Description: Hot Alexa Sexy debuts with this scene, and already with a nice little threesome, which is also happens to be a DP scene. She handles that well, I must say!

May 04, 2019

All Internal - Carla Cruz - Long Time No See Carla

File: teimknaalincarcrur5ysknjgug.mp4

Size: 892.27 MB

Duration: 50:48

Resolution: 960x540

Format: mp4

Description: Long time no see Carla Cruz gets her deep penetrated pussy creampie finally. We literally found this scene on the bottom of a drawer, just so we can deliver after some dust off.

Apr 24, 2019

All Internal - Luna Melba - Slim Luna With A Greatly Shaped Ass

File: pfwccnaalinlunmel4t2mdmqaxn.mp4

Size: 452.71 MB

Duration: 55:53

Resolution: 720x400

Format: mp4

Description: Slim Luna Melba with a greatly shaped ass gets it anal this time. A nice load of super messy creampie, here it comes in her ass!

Mar 20, 2019

All Internal - Annie Wolf - Okay That Serbian Chick

File: qkcownaalinannwolimet94vawp.mp4

Size: 898.56 MB

Duration: 46:51

Resolution: 960x540

Format: mp4

Description: Okay that Serbian chick Annie Wolf drove our guy crazy! Her body is just perfect, tits are great, face is like please fuck me now! ... So, this happened, she was fucked, hard. That scene ending with some nice dripping cum from the pussy, well worth waiting for it!

Mar 10, 2019

All Internal - Marilyn Christal - Marilyn's Hot Body

File: ks9fanaalinmarchreuhiwwdiac.mp4

Size: 1002.12 MB

Duration: 52:49

Resolution: 960x540

Format: mp4

Description: Marilyn Christal's hot body filled up with two of our guys dicks. At the end, these guys formed a line to have their piece of internal cumshot, one at a time, in that fine ass.

Mar 05, 2019

All Internal - Julia Red - Julia Got That Dick Sticked Up Her Butt

File: phapsnaalinjulredvxpnhcetga.mp4

Size: 991.57 MB

Duration: 51:45

Resolution: 960x540

Format: mp4

Description: Julia Red got that dick sticked up her butt straight away, and it stayed there until a really messy creampie occured.

Feb 28, 2019

All Internal - Kate Rich - That Mesmerizing Body

File: ge947naalinkatricn9llbm9v9w.mp4

Size: 968.33 MB

Duration: 50:37

Resolution: 960x540

Format: mp4

Description: That mesmerizing body just asks politely for a great bang, Please fuck me she says. Okay, we replied. And so it happened, until Kate Riches asshole filled with hot jizzy mess...

Feb 16, 2019

All Internal - Ava Black - Real Hottie

File: tduhvnaalinavablaafj4ih39hh.mp4

Size: 998.91 MB

Duration: 52:08

Resolution: 960x540

Format: mp4

Description: Real hottie with great body look at those tits OMG Ava Black had a quick visit on this fine day, just to get us teased with some moves and to have a classic straight to the ass action with super messy creampie ending in that ass of hers...

Feb 08, 2019

All Internal - Cindy Shine - Glamourous Cindy Still Looks Like A Slim, Shy Fashion Model

File: rftqmnaalincinshie13vanvlwb.mp4

Size: 416.93 MB

Duration: 51:33

Resolution: 720x400

Format: mp4

Description: Glamourous Cindy Shine still looks like a slim, shy fashion model, but she proved to have a badgirl side many times already. Here comes another testimony, how she handled that penis in her vagina was just remarkable! No wonder Thomas could not hold her load, and ejected into her deep at the end...

Jan 31, 2019

All Internal - Victoria Velvet - Victoria Has A Wonderful Body

File: twb8unaalinvicvelsvgjtdrri5.mp4

Size: 385.91 MB

Duration: 47:42

Resolution: 720x400

Format: mp4

Description: Victoria Velvet has a wonderful body which just deserves it's right share of dick in her ass really. This is what we did, just gave her what she deserves! Deep anal banging, with a nice creampie ending, dripping cum is guaranteed all over the place!

Jan 15, 2019

All Internal - Melody Petite - Latin Rhymes And Temperature

File: htckmnaalinmelpetldxvds2gem.mp4

Size: 375.32 MB

Duration: 46:10

Resolution: 720x400

Format: mp4

Description: Latin rhymes and temperature, all too obviously there in that great hardcore creampie scene, which features all the great talents Melody Petite has. Enjoy!

Jan 03, 2019

All Internal - Amaris - Mesmerizing Looks From Amaris

File: xtemdnaalinamarovug2zpzwy.mp4

Size: 402.91 MB

Duration: 49:31

Resolution: 720x400

Format: mp4

Description: Mesmerizing looks from Amaris calls out for some rough hardcore sex, which ends in a dripping pussy creampie.

Dec 30, 2018

All Internal - Cindy Shine - Cindy Is A Cheerfull Czechian Babe

File: 4fpzqnaalincinshi15y3ai1ecl.mp4

Size: 394.32 MB

Duration: 48:38

Resolution: 720x400

Format: mp4

Description: Cindy Shine is a cheerfull czechian babe, who just love all forms of sex. In a series of scenes we had the pleasure to shoot with her, she demonstrates it all. This time, this is pure ass to mouts, ass gape, deep anal creampie kind of kink is shown, what we all just LOVE

Dec 18, 2018

All Internal - Ally Style - Hot Czech Ally Got Her Ass Filled In

File: qkqmmnaalinallstytlcqapmdkw.mp4

Size: 422.29 MB

Duration: 52:11

Resolution: 720x400

Format: mp4

Dec 10, 2018

All Internal - Elena Vega - Elena Got A Dick In Her Sight

File: 2pqunnaalinelevegtnyccmydx2.mp4

Size: 1.14 GB

Duration: 01:01:17

Resolution: 960x540

Format: mp4

Dec 02, 2018

All Internal - Di Devi - Bushy Babe Got A Ride On One Of Our Guys Cock

File: zajjvnaalindideved6xs5o4tb.mp4

Size: 911.45 MB

Duration: 47:36

Resolution: 960x540

Format: mp4

Nov 24, 2018

All Internal - Nikki Dream & Nicoletta Noirett - That Threesome Ended Up Pretty Well

File: axk84naalinniknic7wn2tvli25.mp4

Size: 1.07 GB

Duration: 57:25

Resolution: 960x540

Format: mp4

Nov 12, 2018

All Internal - Lady Dee - Real Tease With Her Great Body

File: hwljcnaalinladdeenolyt5lrrn.mp4

Size: 988.48 MB

Duration: 52:05

Resolution: 960x540

Format: mp4

Nov 04, 2018

PornRapidgator.com